Lineage for d3bwaa1 (3bwa A:182-276)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2355401Domain d3bwaa1: 3bwa A:182-276 [155683]
    Other proteins in same PDB: d3bwaa2, d3bwab2, d3bwab3
    automated match to d1a9ea1

Details for d3bwaa1

PDB Entry: 3bwa (more details), 1.3 Å

PDB Description: crystal structure of hla b*3508 in complex with a hcmv 8-mer peptide from the pp65 protein
PDB Compounds: (A:) HLA class I histocompatibility antigen, B-35 alpha chain

SCOPe Domain Sequences for d3bwaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bwaa1 b.1.1.0 (A:182-276) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

SCOPe Domain Coordinates for d3bwaa1:

Click to download the PDB-style file with coordinates for d3bwaa1.
(The format of our PDB-style files is described here.)

Timeline for d3bwaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bwaa2