![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein beta2-microglobulin [88600] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (185 PDB entries) Uniprot P61769 21-119 Uniprot P01884 Uniprot P61769 21-119 ! Uniprot P01884 |
![]() | Domain d3bw9b1: 3bw9 B:0-99 [155682] Other proteins in same PDB: d3bw9a1, d3bw9a2 automatically matched to d1a9bb_ |
PDB Entry: 3bw9 (more details), 1.75 Å
SCOP Domain Sequences for d3bw9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bw9b1 b.1.1.2 (B:0-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d3bw9b1: