Lineage for d3bw9a2 (3bw9 A:1-181)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406849Protein automated matches [191280] (4 species)
    not a true protein
  7. 1406858Species Human (Homo sapiens) [TaxId:9606] [189896] (19 PDB entries)
  8. 1406863Domain d3bw9a2: 3bw9 A:1-181 [155681]
    Other proteins in same PDB: d3bw9a1, d3bw9b_
    automated match to d1xh3a2

Details for d3bw9a2

PDB Entry: 3bw9 (more details), 1.75 Å

PDB Description: crystal structure of hla b*3508 in complex with a hcmv 12-mer peptide from the pp65 protein
PDB Compounds: (A:) HLA class I histocompatibility antigen, B-35 alpha chain

SCOPe Domain Sequences for d3bw9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bw9a2 d.19.1.1 (A:1-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqrrayleglcvewlrrylengketlq
r

SCOPe Domain Coordinates for d3bw9a2:

Click to download the PDB-style file with coordinates for d3bw9a2.
(The format of our PDB-style files is described here.)

Timeline for d3bw9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bw9a1
View in 3D
Domains from other chains:
(mouse over for more information)
d3bw9b_