Lineage for d3bw9a1 (3bw9 A:182-276)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1519292Domain d3bw9a1: 3bw9 A:182-276 [155680]
    Other proteins in same PDB: d3bw9a2, d3bw9b_
    automated match to d1a9ea1

Details for d3bw9a1

PDB Entry: 3bw9 (more details), 1.75 Å

PDB Description: crystal structure of hla b*3508 in complex with a hcmv 12-mer peptide from the pp65 protein
PDB Compounds: (A:) HLA class I histocompatibility antigen, B-35 alpha chain

SCOPe Domain Sequences for d3bw9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bw9a1 b.1.1.0 (A:182-276) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

SCOPe Domain Coordinates for d3bw9a1:

Click to download the PDB-style file with coordinates for d3bw9a1.
(The format of our PDB-style files is described here.)

Timeline for d3bw9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bw9a2
View in 3D
Domains from other chains:
(mouse over for more information)
d3bw9b_