![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (26 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [46507] (3 PDB entries) |
![]() | Domain d2pghd_: 2pgh D: [15568] Other proteins in same PDB: d2pgha_, d2pghc_ complexed with hem |
PDB Entry: 2pgh (more details), 2.8 Å
SCOPe Domain Sequences for d2pghd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pghd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Pig (Sus scrofa) [TaxId: 9823]} vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh dfnpdvqaafqkvvagvanalahkyh
Timeline for d2pghd_: