SCOPe 2.07: Domain d3bvva2: 3bvv A:523-1044

Lineage for d3bvva2 (3bvv A:523-1044)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 protein domains)
   family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
   the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains

6. Protein Golgi alpha-mannosidase II [88657] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88658] (57 PDB entries)
   Uniprot Q24451 94-1107

8. Domain d3bvva2: 3bvv A:523-1044 [155671]
   Other proteins in same PDB: d3bvva1, d3bvva3
   automatically matched to d1htya2
   complexed with mpd, mrd, po4, wz3, zn; mutant

Details for d3bvva2

PDB Entry: 3bvv, 1.3 Å

PDB Description: golgi mannosidase ii d204a catalytic nucleophile mutant complex with methyl alpha-d-mannopyranosyl-(1->3)-[6-thio-alpha-d-mannopyranosyl- (1->6)]-beta-d-mannopyranoside

PDB Compounds: (A:) Alpha-mannosidase 2

SCOPe Domain Sequences for d3bvva2:

Sequence; same for both SEQRES and ATOM records:

>d3bvva2 b.30.5.6 (A:523-1044) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
yftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtd
lannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmglatyvltisdskpe
htsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafseqgllksiqltqd
sphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglps
vvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlnglqfikrrrldkl
plqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrlasdderglgqgv
ldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpldkfifaenewiga
qgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchl
lpnvarcerttltflqnlehldgmvapevcpmetaayvsshs

Timeline for d3bvva2:

• d3bvva2 first appeared in SCOP 1.75
  
• d3bvva2 appears in SCOPe 2.06