![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 proteins) family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains |
![]() | Protein Golgi alpha-mannosidase II [88657] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88658] (57 PDB entries) Uniprot Q24451 94-1107 |
![]() | Domain d3bvua2: 3bvu A:523-1044 [155668] Other proteins in same PDB: d3bvua1, d3bvua3 automatically matched to d1htya2 complexed with mrd, nag, po4, zn; mutant |
PDB Entry: 3bvu (more details), 1.12 Å
SCOPe Domain Sequences for d3bvua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bvua2 b.30.5.6 (A:523-1044) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} yftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtd lannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmglatyvltisdskpe htsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafseqgllksiqltqd sphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglps vvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlnglqfikrrrldkl plqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrlasdderglgqgv ldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpldkfifaenewiga qgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchl lpnvarcerttltflqnlehldgmvapevcpmetaayvsshs
Timeline for d3bvua2: