Lineage for d3bvua1 (3bvu A:412-522)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2697147Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (4 families) (S)
  5. 2697148Family a.8.3.1: alpha-mannosidase, domain 2 [88693] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
  6. 2697149Protein Golgi alpha-mannosidase II [88694] (1 species)
  7. 2697150Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88695] (57 PDB entries)
    Uniprot Q24451 94-1107
  8. 2697152Domain d3bvua1: 3bvu A:412-522 [155667]
    Other proteins in same PDB: d3bvua2, d3bvua3
    automatically matched to d1htya1
    complexed with mrd, nag, po4, zn; mutant

Details for d3bvua1

PDB Entry: 3bvu (more details), 1.12 Å

PDB Description: golgi mannosidase ii d204a catalytic nucleophile mutant complex with methyl(alpha-d-mannopyranosyl)-(1->3)-s-[(alpha-d-mannopyranosyl)-(1- >6)]-alpha-d-mannopyranoside
PDB Compounds: (A:) Alpha-mannosidase 2

SCOPe Domain Sequences for d3bvua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bvua1 a.8.3.1 (A:412-522) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhh
dgitgtakthvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfs

SCOPe Domain Coordinates for d3bvua1:

Click to download the PDB-style file with coordinates for d3bvua1.
(The format of our PDB-style files is described here.)

Timeline for d3bvua1: