![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) ![]() |
![]() | Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
![]() | Protein Fibrinogen gamma chain [88898] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries) Uniprot P02679 |
![]() | Domain d3bvhc1: 3bvh C:102-141 [155663] automatically matched to d1fzac2 complexed with ca |
PDB Entry: 3bvh (more details), 2.6 Å
SCOPe Domain Sequences for d3bvhc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bvhc1 h.1.8.1 (C:102-141) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]} thdssirylqeiynsnnqkivnlkekvaqleaqcqepckd
Timeline for d3bvhc1: