SCOPe 2.06: Domain d3bvdb1: 3bvd B:37-168

Lineage for d3bvdb1 (3bvd B:37-168)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (35 PDB entries)

8. Domain d3bvdb1: 3bvd B:37-168 [155660]
   Other proteins in same PDB: d3bvdb2, d3bvdc1
   automatically matched to d2cuab_
   complexed with cu, cua, has, hem, xe

Details for d3bvdb1

PDB Entry: 3bvd, 3.37 Å

PDB Description: structure of surface-engineered cytochrome ba3 oxidase from thermus thermophilus under xenon pressure, 100psi 5min

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3bvdb1:

Sequence; same for both SEQRES and ATOM records:

>d3bvdb1 b.6.1.2 (B:37-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
lathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpie
vpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglg
hqnmfgtivvke

Timeline for d3bvdb1:

• d3bvdb1 first appeared in SCOP 1.75
  
• d3bvdb1 appears in SCOPe 2.05
  
• d3bvdb1 appears in SCOPe 2.07
  
• d3bvdb1 appears in the current release, SCOPe 2.08