Lineage for d3bvdb1 (3bvd B:37-168)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771043Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2771044Protein Cytochrome c oxidase [49544] (4 species)
  7. 2771160Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (37 PDB entries)
  8. 2771204Domain d3bvdb1: 3bvd B:37-168 [155660]
    Other proteins in same PDB: d3bvdb2, d3bvdc1
    automatically matched to d2cuab_
    complexed with cu, cua, has, hem, xe

Details for d3bvdb1

PDB Entry: 3bvd (more details), 3.37 Å

PDB Description: structure of surface-engineered cytochrome ba3 oxidase from thermus thermophilus under xenon pressure, 100psi 5min
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3bvdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bvdb1 b.6.1.2 (B:37-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
lathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpie
vpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglg
hqnmfgtivvke

SCOPe Domain Coordinates for d3bvdb1:

Click to download the PDB-style file with coordinates for d3bvdb1.
(The format of our PDB-style files is described here.)

Timeline for d3bvdb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bvdb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3bvdc1