Lineage for d3buya2 (3buy A:2-181)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406058Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1406499Species Mouse (Mus musculus), H-2KD [TaxId:10090] [160078] (4 PDB entries)
    Uniprot P01902 22-202
  8. 1406502Domain d3buya2: 3buy A:2-181 [155654]
    Other proteins in same PDB: d3buya1, d3buyb_
    automated match to d1vgka2

Details for d3buya2

PDB Entry: 3buy (more details), 2.6 Å

PDB Description: MHC-I in complex with peptide
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d3buya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3buya2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KD [TaxId: 10090]}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

SCOPe Domain Coordinates for d3buya2:

Click to download the PDB-style file with coordinates for d3buya2.
(The format of our PDB-style files is described here.)

Timeline for d3buya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3buya1
View in 3D
Domains from other chains:
(mouse over for more information)
d3buyb_