SCOPe 2.06: Domain d3buya1: 3buy A:182-276

Lineage for d3buya1 (3buy A:182-276)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (109 PDB entries)
   Uniprot P01901 22-299

8. Domain d3buya1: 3buy A:182-276 [155653]
   Other proteins in same PDB: d3buya2, d3buyb_
   automated match to d2fwoa1

Details for d3buya1

PDB Entry: 3buy, 2.6 Å

PDB Description: MHC-I in complex with peptide

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d3buya1:

Sequence; same for both SEQRES and ATOM records:

>d3buya1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

Timeline for d3buya1:

• d3buya1 first appeared in SCOP 1.75
  
• d3buya1 appears in SCOPe 2.05
  
• d3buya1 appears in SCOPe 2.07
  
• d3buya1 appears in the current release, SCOPe 2.08