Lineage for d3buxd1 (3bux D:178-263)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 769152Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (8 proteins)
  6. 769156Protein Cbl [47561] (1 species)
  7. 769157Species Human (Homo sapiens) [TaxId:9606] [47562] (9 PDB entries)
  8. 769159Domain d3buxd1: 3bux D:178-263 [155650]
    Other proteins in same PDB: d3buxb2, d3buxb3, d3buxd2, d3buxd3
    automatically matched to d1b47a1

Details for d3buxd1

PDB Entry: 3bux (more details), 1.35 Å

PDB Description: crystal structure of c-cbl-tkb domain complexed with its binding motif in c-met
PDB Compounds: (D:) E3 ubiquitin-protein ligase CBL

SCOP Domain Sequences for d3buxd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3buxd1 a.39.1.7 (D:178-263) Cbl {Human (Homo sapiens) [TaxId: 9606]}
tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkstidltcndyis
vfefdiftrlfqpwssllrnwnslav

SCOP Domain Coordinates for d3buxd1:

Click to download the PDB-style file with coordinates for d3buxd1.
(The format of our PDB-style files is described here.)

Timeline for d3buxd1: