SCOPe 2.08: Domain d3buxb3: 3bux B:264-351

Lineage for d3buxb3 (3bux B:264-351)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Cbl [55587] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55588] (12 PDB entries)

8. Domain d3buxb3: 3bux B:264-351 [155649]
   Other proteins in same PDB: d3buxb1, d3buxb2, d3buxd1, d3buxd2
   automatically matched to d1fbva3

Details for d3buxb3

PDB Entry: 3bux, 1.35 Å

PDB Description: crystal structure of c-cbl-tkb domain complexed with its binding motif in c-met

PDB Compounds: (B:) E3 ubiquitin-protein ligase CBL

SCOPe Domain Sequences for d3buxb3:

Sequence; same for both SEQRES and ATOM records:

>d3buxb3 d.93.1.1 (B:264-351) Cbl {Human (Homo sapiens) [TaxId: 9606]}
thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp
lfqalidgfregfylfpdgrnqnpdltg

Timeline for d3buxb3:

• d3buxb3 first appeared in SCOP 1.75
  
• d3buxb3 appears in SCOPe 2.07