Lineage for d3buqa2 (3buq A:523-1044)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1119824Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1119951Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 1120221Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
    the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains
  6. 1120222Protein Golgi alpha-mannosidase II [88657] (1 species)
  7. 1120223Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88658] (46 PDB entries)
    Uniprot Q24451 94-1107
  8. 1120267Domain d3buqa2: 3buq A:523-1044 [155639]
    Other proteins in same PDB: d3buqa1, d3buqa3
    automatically matched to d1htya2
    complexed with man, mpd, nag, zn; mutant

Details for d3buqa2

PDB Entry: 3buq (more details), 2.01 Å

PDB Description: golgi alpha-mannosidase ii d204a catalytic nucleophile mutant with bound mannose.
PDB Compounds: (A:) Alpha-mannosidase 2

SCOPe Domain Sequences for d3buqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3buqa2 b.30.5.6 (A:523-1044) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
yftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtd
lannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmglatyvltisdskpe
htsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafseqgllksiqltqd
sphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglps
vvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlnglqfikrrrldkl
plqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrlasdderglgqgv
ldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpldkfifaenewiga
qgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchl
lpnvarcerttltflqnlehldgmvapevcpmetaayvsshs

SCOPe Domain Coordinates for d3buqa2:

Click to download the PDB-style file with coordinates for d3buqa2.
(The format of our PDB-style files is described here.)

Timeline for d3buqa2: