SCOPe 2.05: Domain d3buod1: 3buo D:178-263

Lineage for d3buod1 (3buo D:178-263)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)

6. Protein Cbl [47561] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47562] (10 PDB entries)

8. Domain d3buod1: 3buo D:178-263 [155632]
   Other proteins in same PDB: d3buob2, d3buob3, d3buod2, d3buod3
   automatically matched to d1b47a1

Details for d3buod1

PDB Entry: 3buo, 2.6 Å

PDB Description: crystal structure of c-cbl-tkb domain complexed with its binding motif in egf receptor'

PDB Compounds: (D:) E3 ubiquitin-protein ligase CBL

SCOPe Domain Sequences for d3buod1:

Sequence; same for both SEQRES and ATOM records:

>d3buod1 a.39.1.7 (D:178-263) Cbl {Human (Homo sapiens) [TaxId: 9606]}
tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkstidltcndyis
vfefdiftrlfqpwssllrnwnslav

Timeline for d3buod1:

• d3buod1 first appeared in SCOP 1.75
  
• d3buod1 appears in SCOPe 2.04
  
• d3buod1 appears in SCOPe 2.06
  
• d3buod1 appears in the current release, SCOPe 2.08