Lineage for d1g09b_ (1g09 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687041Species Cow (Bos taurus) [TaxId:9913] [46506] (13 PDB entries)
  8. 2687056Domain d1g09b_: 1g09 B: [15563]
    Other proteins in same PDB: d1g09a_, d1g09c_
    complexed with cmo, hem

Details for d1g09b_

PDB Entry: 1g09 (more details), 2.04 Å

PDB Description: carbonmonoxy liganded bovine hemoglobin ph 7.2
PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1g09b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g09b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cow (Bos taurus) [TaxId: 9913]}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

SCOPe Domain Coordinates for d1g09b_:

Click to download the PDB-style file with coordinates for d1g09b_.
(The format of our PDB-style files is described here.)

Timeline for d1g09b_: