Lineage for d3bumb3 (3bum B:264-351)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2571842Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2571951Protein Cbl [55587] (1 species)
  7. 2571952Species Human (Homo sapiens) [TaxId:9606] [55588] (12 PDB entries)
  8. 2571962Domain d3bumb3: 3bum B:264-351 [155625]
    Other proteins in same PDB: d3bumb1, d3bumb2
    automated match to d1b47a3

Details for d3bumb3

PDB Entry: 3bum (more details), 2 Å

PDB Description: crystal structure of c-cbl-tkb domain complexed with its binding motif in sprouty2
PDB Compounds: (B:) E3 ubiquitin-protein ligase CBL

SCOPe Domain Sequences for d3bumb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bumb3 d.93.1.1 (B:264-351) Cbl {Human (Homo sapiens) [TaxId: 9606]}
thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp
lfqalidgfregfylfpdgrnqnpdltg

SCOPe Domain Coordinates for d3bumb3:

Click to download the PDB-style file with coordinates for d3bumb3.
(The format of our PDB-style files is described here.)

Timeline for d3bumb3: