Lineage for d3bumb1 (3bum B:178-263)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2319425Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2320611Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 protein domains)
  6. 2320615Protein Cbl [47561] (1 species)
  7. 2320616Species Human (Homo sapiens) [TaxId:9606] [47562] (11 PDB entries)
  8. 2320626Domain d3bumb1: 3bum B:178-263 [155623]
    Other proteins in same PDB: d3bumb2, d3bumb3
    automated match to d3buxb1

Details for d3bumb1

PDB Entry: 3bum (more details), 2 Å

PDB Description: crystal structure of c-cbl-tkb domain complexed with its binding motif in sprouty2
PDB Compounds: (B:) E3 ubiquitin-protein ligase CBL

SCOPe Domain Sequences for d3bumb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bumb1 a.39.1.7 (B:178-263) Cbl {Human (Homo sapiens) [TaxId: 9606]}
tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkstidltcndyis
vfefdiftrlfqpwssllrnwnslav

SCOPe Domain Coordinates for d3bumb1:

Click to download the PDB-style file with coordinates for d3bumb1.
(The format of our PDB-style files is described here.)

Timeline for d3bumb1: