SCOP 1.75: Domain d3bula1: 3bul A:651-740

Lineage for d3bula1 (3bul A:651-740)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.1: Methionine synthase domain [47644] (1 family)

5. Family a.46.1.1: Methionine synthase domain [47645] (1 protein)

6. Protein Methionine synthase domain [47646] (1 species)

7. Species Escherichia coli [TaxId:562] [47647] (4 PDB entries)

8. Domain d3bula1: 3bul A:651-740 [155620]
   Other proteins in same PDB: d3bula2, d3bula3
   automatically matched to d1bmta1
   complexed with b12; mutant

Details for d3bula1

PDB Entry: 3bul, 2.3 Å

PDB Description: e. coli i690c/g743c meth c-terminal fragment (649-1227)

PDB Compounds: (A:) methionine synthase

SCOP Domain Sequences for d3bula1:

Sequence; same for both SEQRES and ATOM records:

>d3bula1 a.46.1.1 (A:651-740) Methionine synthase domain {Escherichia coli [TaxId: 562]}
qaewrswevnkrleyslvkgitefieqdteearqqatrpceviegplmdgmnvvgdlfge
gkmflpqvvksarvmkqavaylepfieask

Timeline for d3bula1:

• d3bula1 is new in SCOP 1.75
  
• d3bula1 appears in SCOPe 2.01
  
• d3bula1 appears in the current release, SCOPe 2.08