Lineage for d3bukd3 (3buk D:96-137)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1064701Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 1064702Superfamily g.24.1: TNF receptor-like [57586] (2 families) (S)
  5. 1064703Family g.24.1.1: TNF receptor-like [57587] (5 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 1064753Protein Low affinity neurotrophin receptor p75NTR [111413] (1 species)
  7. 1064754Species Norway rat (Rattus norvegicus) [TaxId:10116] [111414] (2 PDB entries)
    Uniprot P07174 31-190 # fragment contains 3 complete and 1 partial (C-terminal) 'domains'
  8. 1064765Domain d3bukd3: 3buk D:96-137 [155618]
    Other proteins in same PDB: d3buka_, d3bukb_
    automatically matched to d1sg1x3
    complexed with nag

Details for d3bukd3

PDB Entry: 3buk (more details), 2.6 Å

PDB Description: crystal structure of the neurotrophin-3 and p75ntr symmetrical complex
PDB Compounds: (D:) Tumor necrosis factor receptor superfamily member 16

SCOPe Domain Sequences for d3bukd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bukd3 g.24.1.1 (D:96-137) Low affinity neurotrophin receptor p75NTR {Norway rat (Rattus norvegicus) [TaxId: 10116]}
acsvcevgsglvfscqdkqntvceecpegtysdeanhvdpcl

SCOPe Domain Coordinates for d3bukd3:

Click to download the PDB-style file with coordinates for d3bukd3.
(The format of our PDB-style files is described here.)

Timeline for d3bukd3: