SCOPe 2.08: Domain d3bukd1: 3buk D:3-56

Lineage for d3bukd1 (3buk D:3-56)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.24: TNF receptor-like [57585] (1 superfamily)
   duplication: consists of three similar disulfide-rich domains

4. Superfamily g.24.1: TNF receptor-like [57586] (3 families)

5. Family g.24.1.1: TNF receptor-like [57587] (13 proteins)
   Pfam PF00020; TNFR/NGFR cysteine-rich region

6. Protein Low affinity neurotrophin receptor p75NTR, domain 1 [419062] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [419553] (2 PDB entries)
   Uniprot P07174 31-190 ; species # fragment contains 3 complete and 1 partial (C-terminal) 'domains'

8. Domain d3bukd1: 3buk D:3-56 [155616]
   Other proteins in same PDB: d3buka_, d3bukb_, d3bukc2, d3bukc3, d3bukc4, d3bukd2, d3bukd3, d3bukd4
   automated match to d1sg1x1
   complexed with nag
   has additional secondary structure elements or disulfide bonds beyond those in the common domain

Details for d3bukd1

PDB Entry: 3buk, 2.6 Å

PDB Description: crystal structure of the neurotrophin-3 and p75ntr symmetrical complex

PDB Compounds: (D:) Tumor necrosis factor receptor superfamily member 16

SCOPe Domain Sequences for d3bukd1:

Sequence; same for both SEQRES and ATOM records:

>d3bukd1 g.24.1.1 (D:3-56) Low affinity neurotrophin receptor p75NTR, domain 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tcstglythsgecckacnlgegvaqpcganqtvcepcldsvtfsdvvsatepck

Timeline for d3bukd1:

• d3bukd1 first appeared in SCOP 1.75
  
• d3bukd1 appears in SCOPe 2.07