Class g: Small proteins [56992] (98 folds) |
Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
Superfamily g.24.1: TNF receptor-like [57586] (3 families) |
Family g.24.1.1: TNF receptor-like [57587] (6 proteins) Pfam PF00020; TNFR/NGFR cysteine-rich region |
Protein Low affinity neurotrophin receptor p75NTR [111413] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [111414] (2 PDB entries) Uniprot P07174 31-190 # fragment contains 3 complete and 1 partial (C-terminal) 'domains' |
Domain d3bukc3: 3buk C:96-137 [155614] Other proteins in same PDB: d3buka_, d3bukb_ automated match to d1sg1x3 complexed with nag |
PDB Entry: 3buk (more details), 2.6 Å
SCOPe Domain Sequences for d3bukc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bukc3 g.24.1.1 (C:96-137) Low affinity neurotrophin receptor p75NTR {Norway rat (Rattus norvegicus) [TaxId: 10116]} acsvcevgsglvfscqdkqntvceecpegtysdeanhvdpcl
Timeline for d3bukc3: