Lineage for d3bukc2 (3buk C:57-95)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034651Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 3034652Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 3034653Family g.24.1.1: TNF receptor-like [57587] (13 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. Protein Low affinity neurotrophin receptor p75NTR, domain 2 and domain 3 [419063] (1 species)
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [419554] (2 PDB entries)
    Uniprot P07174 31-190 ; species # fragment contains 3 complete and 1 partial (C-terminal) 'domains'
  8. 3034717Domain d3bukc2: 3buk C:57-95 [155613]
    Other proteins in same PDB: d3buka_, d3bukb_, d3bukc1, d3bukc4, d3bukd1, d3bukd4
    automated match to d1sg1x2
    complexed with nag

Details for d3bukc2

PDB Entry: 3buk (more details), 2.6 Å

PDB Description: crystal structure of the neurotrophin-3 and p75ntr symmetrical complex
PDB Compounds: (C:) Tumor necrosis factor receptor superfamily member 16

SCOPe Domain Sequences for d3bukc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bukc2 g.24.1.1 (C:57-95) Low affinity neurotrophin receptor p75NTR, domain 2 and domain 3 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pcteclglqsmsapcveaddavcrcaygyyqdeetghce

SCOPe Domain Coordinates for d3bukc2:

Click to download the PDB-style file with coordinates for d3bukc2.
(The format of our PDB-style files is described here.)

Timeline for d3bukc2: