Lineage for d3bukc1 (3buk C:3-56)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639372Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 2639373Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 2639374Family g.24.1.1: TNF receptor-like [57587] (6 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 2639425Protein Low affinity neurotrophin receptor p75NTR [111413] (1 species)
  7. 2639426Species Norway rat (Rattus norvegicus) [TaxId:10116] [111414] (2 PDB entries)
    Uniprot P07174 31-190 # fragment contains 3 complete and 1 partial (C-terminal) 'domains'
  8. 2639431Domain d3bukc1: 3buk C:3-56 [155612]
    Other proteins in same PDB: d3buka_, d3bukb_
    automated match to d1sg1x1
    complexed with nag

Details for d3bukc1

PDB Entry: 3buk (more details), 2.6 Å

PDB Description: crystal structure of the neurotrophin-3 and p75ntr symmetrical complex
PDB Compounds: (C:) Tumor necrosis factor receptor superfamily member 16

SCOPe Domain Sequences for d3bukc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bukc1 g.24.1.1 (C:3-56) Low affinity neurotrophin receptor p75NTR {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tcstglythsgecckacnlgegvaqpcganqtvcepcldsvtfsdvvsatepck

SCOPe Domain Coordinates for d3bukc1:

Click to download the PDB-style file with coordinates for d3bukc1.
(The format of our PDB-style files is described here.)

Timeline for d3bukc1: