Class g: Small proteins [56992] (100 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.3: Neurotrophin [57520] (5 proteins) automatically mapped to Pfam PF00243 |
Protein automated matches [190424] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187311] (1 PDB entry) |
Domain d3bukb_: 3buk B: [155611] Other proteins in same PDB: d3bukc1, d3bukc2, d3bukc3, d3bukc4, d3bukd1, d3bukd2, d3bukd3, d3bukd4 automated match to d1nt3a_ complexed with nag |
PDB Entry: 3buk (more details), 2.6 Å
SCOPe Domain Sequences for d3bukb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bukb_ g.17.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kshrgeysvcdseslwvtdkssaidirghqvtvlgeiktgnspvkqyfyetrckearpvk ngcrgiddkhwnsqcktsqtyvraltsennklvgwrwiridtscvcalsrk
Timeline for d3bukb_: