Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands |
Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) in the different families beta-barrels are similarly distorted but may vary in the number of strands |
Family c.6.2.1: alpha-mannosidase [88714] (2 proteins) family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family |
Protein Golgi alpha-mannosidase II [88715] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88716] (57 PDB entries) Uniprot Q24451 94-1107 |
Domain d3buia3: 3bui A:31-411 [155609] Other proteins in same PDB: d3buia1, d3buia2 automatically matched to d1htya3 complexed with mpd, trs, zn; mutant |
PDB Entry: 3bui (more details), 1.25 Å
SCOPe Domain Sequences for d3buia3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3buia3 c.6.2.1 (A:31-411) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} cqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphsh ndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqmk sivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaiapfghsp tmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysyd iphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaelyr tnvlliplgddfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqae ragqaefptlsgdfftyadrs
Timeline for d3buia3: