Lineage for d3buda3 (3bud A:31-411)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 823184Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 823227Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (8 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 823228Family c.6.2.1: alpha-mannosidase [88714] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
  6. 823229Protein Golgi alpha-mannosidase II [88715] (1 species)
  7. 823230Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88716] (46 PDB entries)
    Uniprot Q24451 94-1107
  8. 823266Domain d3buda3: 3bud A:31-411 [155606]
    Other proteins in same PDB: d3buda1, d3buda2
    automatically matched to d1htya3
    complexed with mpd, nag, po4, zn; mutant

Details for d3buda3

PDB Entry: 3bud (more details), 1.85 Å

PDB Description: golgi mannosidase ii d204a catalytic nucleophile mutant with an empty active site
PDB Compounds: (A:) Alpha-mannosidase 2

SCOP Domain Sequences for d3buda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3buda3 c.6.2.1 (A:31-411) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
cqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphsh
ndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqmk
sivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaiapfghsp
tmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysyd
iphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaelyr
tnvlliplgddfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqae
ragqaefptlsgdfftyadrs

SCOP Domain Coordinates for d3buda3:

Click to download the PDB-style file with coordinates for d3buda3.
(The format of our PDB-style files is described here.)

Timeline for d3buda3: