Lineage for d1g08d_ (1g08 D:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 275721Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 275722Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 275747Family a.1.1.2: Globins [46463] (18 proteins)
    Heme-binding protein
  6. 276117Protein Hemoglobin, beta-chain [46500] (18 species)
  7. 276135Species Cow (Bos taurus) [TaxId:9913] [46506] (5 PDB entries)
  8. 276137Domain d1g08d_: 1g08 D: [15560]
    Other proteins in same PDB: d1g08a_, d1g08c_
    complexed with cmo, hem

Details for d1g08d_

PDB Entry: 1g08 (more details), 1.9 Å

PDB Description: carbonmonoxy liganded bovine hemoglobin ph 5.0

SCOP Domain Sequences for d1g08d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g08d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Cow (Bos taurus)}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

SCOP Domain Coordinates for d1g08d_:

Click to download the PDB-style file with coordinates for d1g08d_.
(The format of our PDB-style files is described here.)

Timeline for d1g08d_: