Lineage for d3buab1 (3bua B:44-245)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779007Fold a.146: Telomeric repeat binding factor (TRF) dimerisation domain [63599] (1 superfamily)
    multihelical; can be divided into an alpha-alpha superhelix domain and a long alpha-hairpin dimerization domain
  4. 779008Superfamily a.146.1: Telomeric repeat binding factor (TRF) dimerisation domain [63600] (1 family) (S)
  5. 779009Family a.146.1.1: Telomeric repeat binding factor (TRF) dimerisation domain [63601] (2 proteins)
  6. 779014Protein TRF2 [63604] (1 species)
  7. 779015Species Human (Homo sapiens) [TaxId:9606] [63605] (3 PDB entries)
  8. 779021Domain d3buab1: 3bua B:44-245 [155598]
    automatically matched to d1h6pa_

Details for d3buab1

PDB Entry: 3bua (more details), 2.5 Å

PDB Description: Crystal Structure of TRF2 TRFH domain and APOLLO peptide complex
PDB Compounds: (B:) Telomeric repeat-binding factor 2

SCOP Domain Sequences for d3buab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3buab1 a.146.1.1 (B:44-245) TRF2 {Human (Homo sapiens) [TaxId: 9606]}
gearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrllrv
mqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaavi
iciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkmlr
fleshlddaepylltmakkalk

SCOP Domain Coordinates for d3buab1:

Click to download the PDB-style file with coordinates for d3buab1.
(The format of our PDB-style files is described here.)

Timeline for d3buab1: