SCOPe 2.07: Domain d3buaa_: 3bua A:

Lineage for d3buaa_ (3bua A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.146: Telomeric repeat binding factor (TRF) dimerisation domain [63599] (1 superfamily)
   multihelical; can be divided into an alpha-alpha superhelix domain and a long alpha-hairpin dimerization domain

4. Superfamily a.146.1: Telomeric repeat binding factor (TRF) dimerisation domain [63600] (1 family)
   automatically mapped to Pfam PF08558

5. Family a.146.1.1: Telomeric repeat binding factor (TRF) dimerisation domain [63601] (3 proteins)

6. Protein TRF2 [63604] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63605] (3 PDB entries)

8. Domain d3buaa_: 3bua A: [155597]
   automated match to d1h6pa_
   protein/DNA complex

Details for d3buaa_

PDB Entry: 3bua, 2.5 Å

PDB Description: Crystal Structure of TRF2 TRFH domain and APOLLO peptide complex

PDB Compounds: (A:) Telomeric repeat-binding factor 2

SCOPe Domain Sequences for d3buaa_:

Sequence; same for both SEQRES and ATOM records:

>d3buaa_ a.146.1.1 (A:) TRF2 {Human (Homo sapiens) [TaxId: 9606]}
gearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrllrv
mqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaavi
iciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkmlr
fleshlddaepylltmakkalk

Timeline for d3buaa_:

• d3buaa_ first appeared in SCOP 1.75, called d3buaa1
  
• d3buaa_ appears in SCOPe 2.06
  
• d3buaa_ appears in the current release, SCOPe 2.08