SCOPe 2.03: Domain d3bu8a1: 3bu8 A:44-245

Lineage for d3bu8a1 (3bu8 A:44-245)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.146: Telomeric repeat binding factor (TRF) dimerisation domain [63599] (1 superfamily)
   multihelical; can be divided into an alpha-alpha superhelix domain and a long alpha-hairpin dimerization domain

4. Superfamily a.146.1: Telomeric repeat binding factor (TRF) dimerisation domain [63600] (1 family)
   automatically mapped to Pfam PF08558

5. Family a.146.1.1: Telomeric repeat binding factor (TRF) dimerisation domain [63601] (2 proteins)

6. Protein TRF2 [63604] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63605] (3 PDB entries)

8. Domain d3bu8a1: 3bu8 A:44-245 [155595]
   automatically matched to d1h6pa_
   protein/DNA complex

Details for d3bu8a1

PDB Entry: 3bu8, 2.15 Å

PDB Description: Crystal Structure of TRF2 TRFH domain and TIN2 peptide complex

PDB Compounds: (A:) Telomeric repeat-binding factor 2

SCOPe Domain Sequences for d3bu8a1:

Sequence; same for both SEQRES and ATOM records:

>d3bu8a1 a.146.1.1 (A:44-245) TRF2 {Human (Homo sapiens) [TaxId: 9606]}
gearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrllrv
mqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaavi
iciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkmlr
fleshlddaepylltmakkalk

Timeline for d3bu8a1:

• d3bu8a1 first appeared in SCOP 1.75
  
• d3bu8a1 appears in SCOPe 2.02
  
• d3bu8a1 is called d3bu8a_ in SCOPe 2.04
  
• d3bu8a1 appears in the current release, SCOPe 2.08, called d3bu8a_