Lineage for d3bu6a_ (3bu6 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1043032Protein Insulin receptor [56162] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 1043033Species Human (Homo sapiens) [TaxId:9606] [56163] (15 PDB entries)
  8. 1043036Domain d3bu6a_: 3bu6 A: [155592]
    automated match to d1p14a_

Details for d3bu6a_

PDB Entry: 3bu6 (more details), 1.95 Å

PDB Description: crystal structure of the insulin receptor kinase in complex with irs2 krlb phosphopeptide
PDB Compounds: (A:) insulin receptor subunit beta

SCOPe Domain Sequences for d3bu6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bu6a_ d.144.1.7 (A:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln
easvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptl
qemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkg
gkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg
yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk

SCOPe Domain Coordinates for d3bu6a_:

Click to download the PDB-style file with coordinates for d3bu6a_.
(The format of our PDB-style files is described here.)

Timeline for d3bu6a_: