Lineage for d1g08b_ (1g08 B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 632305Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 632329Species Cow (Bos taurus) [TaxId:9913] [46506] (5 PDB entries)
  8. 632330Domain d1g08b_: 1g08 B: [15559]
    Other proteins in same PDB: d1g08a_, d1g08c_

Details for d1g08b_

PDB Entry: 1g08 (more details), 1.9 Å

PDB Description: carbonmonoxy liganded bovine hemoglobin ph 5.0
PDB Compounds: (B:) hemoglobin beta chain

SCOP Domain Sequences for d1g08b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g08b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cow (Bos taurus) [TaxId: 9913]}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

SCOP Domain Coordinates for d1g08b_:

Click to download the PDB-style file with coordinates for d1g08b_.
(The format of our PDB-style files is described here.)

Timeline for d1g08b_: