Lineage for d3btle2 (3btl E:73-187)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776253Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 776254Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 776255Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins)
  6. 776284Protein Multidrug binding protein QacR [69107] (1 species)
  7. 776285Species Staphylococcus aureus [TaxId:1280] [69108] (20 PDB entries)
    Uniprot P23217
  8. 776317Domain d3btle2: 3btl E:73-187 [155589]
    Other proteins in same PDB: d3btla1, d3btlb1, d3btld1, d3btle1
    automatically matched to d1jt0a2
    complexed with mgr, so4; mutant

Details for d3btle2

PDB Entry: 3btl (more details), 2.9 Å

PDB Description: crystal structure of QacR(E58Q) bound to malachite green
PDB Compounds: (E:) HTH-type transcriptional regulator qacR

SCOP Domain Sequences for d3btle2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3btle2 a.121.1.1 (E:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

SCOP Domain Coordinates for d3btle2:

Click to download the PDB-style file with coordinates for d3btle2.
(The format of our PDB-style files is described here.)

Timeline for d3btle2: