![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
![]() | Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
![]() | Protein Multidrug binding protein QacR [69107] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [69108] (24 PDB entries) Uniprot P23217 |
![]() | Domain d3btld2: 3btl D:73-187 [155587] Other proteins in same PDB: d3btla1, d3btlb1, d3btld1, d3btle1 automatically matched to d1jt0a2 complexed with mgr, so4 |
PDB Entry: 3btl (more details), 2.9 Å
SCOPe Domain Sequences for d3btld2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3btld2 a.121.1.1 (D:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls
Timeline for d3btld2: