Lineage for d1hdsd_ (1hds D:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44242Protein Hemoglobin, beta-chain [46500] (16 species)
  7. 44271Species Deer (Odocoileus virginianus) [TaxId:9874] [46505] (1 PDB entry)
  8. 44273Domain d1hdsd_: 1hds D: [15558]
    Other proteins in same PDB: d1hdsa_, d1hdsc_

Details for d1hdsd_

PDB Entry: 1hds (more details), 1.98 Å

PDB Description: macromolecular structure refinement by restrained least-squares and interactive graphics as applied to sickling deer type iii hemoglobin

SCOP Domain Sequences for d1hdsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdsd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Deer (Odocoileus virginianus)}
mltaeekaavtgfwgkvdvdvvgaqalgrllvvypwtqrffqhfgnlssagavmnnpkvk
ahgkrvldaftqglkhlddlkgafaqlsglhcnklhvnpqnfrllgnvlalvvarnfggq
ftpnvqalfqkvvagvanalahkyh

SCOP Domain Coordinates for d1hdsd_:

Click to download the PDB-style file with coordinates for d1hdsd_.
(The format of our PDB-style files is described here.)

Timeline for d1hdsd_: