![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Multidrug binding protein QacR [68964] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries) Uniprot P23217 |
![]() | Domain d3btie1: 3bti E:2-72 [155572] Other proteins in same PDB: d3btia2, d3btib2, d3btid2, d3btie2 automatically matched to d1jt0a1 complexed with ber, so4 |
PDB Entry: 3bti (more details), 2.85 Å
SCOPe Domain Sequences for d3btie1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3btie1 a.4.1.9 (E:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieqskw qeqwkkeqika
Timeline for d3btie1: