![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (25 species) |
![]() | Species Deer (Odocoileus virginianus) [TaxId:9874] [46505] (1 PDB entry) |
![]() | Domain d1hdsb_: 1hds B: [15557] Other proteins in same PDB: d1hdsa_, d1hdsc_ complexed with hem |
PDB Entry: 1hds (more details), 1.98 Å
SCOPe Domain Sequences for d1hdsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdsb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Deer (Odocoileus virginianus) [TaxId: 9874]} mltaeekaavtgfwgkvdvdvvgaqalgrllvvypwtqrffqhfgnlssagavmnnpkvk ahgkrvldaftqglkhlddlkgafaqlsglhcnklhvnpqnfrllgnvlalvvarnfggq ftpnvqalfqkvvagvanalahkyh
Timeline for d1hdsb_: