SCOP 1.75: Domain d3btia1: 3bti A:2-72

Lineage for d3btia1 (3bti A:2-72)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (19 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)

6. Protein Multidrug binding protein QacR [68964] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [68965] (20 PDB entries)
   Uniprot P23217

8. Domain d3btia1: 3bti A:2-72 [155566]
   Other proteins in same PDB: d3btia2, d3btib2, d3btid2, d3btie2
   automatically matched to d1jt0a1
   complexed with ber, so4; mutant

Details for d3btia1

PDB Entry: 3bti, 2.85 Å

PDB Description: crystal structure of qacr(e58q) bound to berberine

PDB Compounds: (A:) HTH-type transcriptional regulator qacR

SCOP Domain Sequences for d3btia1:

Sequence; same for both SEQRES and ATOM records:

>d3btia1 a.4.1.9 (A:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieqskw
qeqwkkeqika

Timeline for d3btia1:

• d3btia1 is new in SCOP 1.75
  
• d3btia1 appears in SCOPe 2.01
  
• d3btia1 appears in the current release, SCOPe 2.08