Lineage for d3btcd1 (3btc D:2-72)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761140Superfamily a.4.1: Homeodomain-like [46689] (19 families) (S)
    consists only of helices
  5. 761504Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)
  6. 761533Protein Multidrug binding protein QacR [68964] (1 species)
  7. 761534Species Staphylococcus aureus [TaxId:1280] [68965] (20 PDB entries)
    Uniprot P23217
  8. 761593Domain d3btcd1: 3btc D:2-72 [155562]
    Other proteins in same PDB: d3btca2, d3btcb2, d3btcd2, d3btce2
    automatically matched to d1jt0a1
    complexed with mgr, so4; mutant

Details for d3btcd1

PDB Entry: 3btc (more details), 2.9 Å

PDB Description: crystal structure of qacr(e57q) bound to malachite green
PDB Compounds: (D:) HTH-type transcriptional regulator qacR

SCOP Domain Sequences for d3btcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3btcd1 a.4.1.9 (D:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilniqeskw
qeqwkkeqika

SCOP Domain Coordinates for d3btcd1:

Click to download the PDB-style file with coordinates for d3btcd1.
(The format of our PDB-style files is described here.)

Timeline for d3btcd1: