SCOPe 2.08: Domain d3btcd1: 3btc D:2-72

Lineage for d3btcd1 (3btc D:2-72)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (21 families)
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
Protein Multidrug binding protein QacR [68964] (1 species)
Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
Uniprot P23217
Domain d3btcd1: 3btc D:2-72 [155562]
Other proteins in same PDB: d3btca2, d3btcb2, d3btcd2, d3btce2
automatically matched to d1jt0a1
complexed with mgr, so4

Details for d3btcd1

PDB Entry: 3btc (more details), 2.9 Å

PDB Description: crystal structure of qacr(e57q) bound to malachite green

PDB Compounds: (D:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d3btcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3btcd1 a.4.1.9 (D:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilniqeskw
qeqwkkeqika

SCOPe Domain Coordinates for d3btcd1:

Click to download the PDB-style file with coordinates for d3btcd1.
(The format of our PDB-style files is described here.)

Timeline for d3btcd1: