| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
| Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
| Protein Multidrug binding protein QacR [69107] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [69108] (24 PDB entries) Uniprot P23217 |
| Domain d3btcb2: 3btc B:73-187 [155561] Other proteins in same PDB: d3btca1, d3btcb1, d3btcd1, d3btce1 automatically matched to d1jt0a2 complexed with mgr, so4 |
PDB Entry: 3btc (more details), 2.9 Å
SCOPe Domain Sequences for d3btcb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3btcb2 a.121.1.1 (B:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls
Timeline for d3btcb2: