SCOPe 2.03: Domain d3bt9e1: 3bt9 E:2-72

Lineage for d3bt9e1 (3bt9 E:2-72)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Multidrug binding protein QacR [68964] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
   Uniprot P23217

8. Domain d3bt9e1: 3bt9 E:2-72 [155556]
   Other proteins in same PDB: d3bt9a2, d3bt9b2, d3bt9d2, d3bt9e2
   automatically matched to d1jt0a1
   complexed with deq, so4

Details for d3bt9e1

PDB Entry: 3bt9, 2.75 Å

PDB Description: crystal structure of qacr(e57q) bound to dequalinium

PDB Compounds: (E:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d3bt9e1:

Sequence; same for both SEQRES and ATOM records:

>d3bt9e1 a.4.1.9 (E:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilniqeskw
qeqwkkeqika

Timeline for d3bt9e1:

• d3bt9e1 first appeared in SCOP 1.75
  
• d3bt9e1 appears in SCOPe 2.02
  
• d3bt9e1 appears in SCOPe 2.04
  
• d3bt9e1 appears in the current release, SCOPe 2.08