Lineage for d3bt2u3 (3bt2 U:87-187)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1962063Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1962064Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1962288Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 1962355Protein Urokinase plasminogen activator surface receptor uPAR [161128] (1 species)
    duplication: tandem repeat of three similar domains; the N-terminal and C-terminal domains belong to Pfam PF00021; uPAR/Ly6
  7. 1962356Species Human (Homo sapiens) [TaxId:9606] [161129] (6 PDB entries)
    Uniprot Q03405 109-209! Uniprot Q03405 210-299! Uniprot Q03405 23-108
  8. 1962362Domain d3bt2u3: 3bt2 U:87-187 [155549]
    Other proteins in same PDB: d3bt2a1, d3bt2a2, d3bt2b_, d3bt2h1, d3bt2h2, d3bt2l1, d3bt2l2
    automated match to d2i9be3
    complexed with nag

Details for d3bt2u3

PDB Entry: 3bt2 (more details), 2.5 Å

PDB Description: structure of urokinase receptor, urokinase and vitronectin complex
PDB Compounds: (U:) Urokinase plasminogen activator surface receptor

SCOPe Domain Sequences for d3bt2u3:

Sequence, based on SEQRES records: (download)

>d3bt2u3 g.7.1.3 (U:87-187) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
ysrsryleciscgssdmscergrhqslqcrspeeqcldvvthwiqegeegrpkddrhlrg
cgylpgcpgsngfhnndtfhflkccnttkcnegpilelenl

Sequence, based on observed residues (ATOM records): (download)

>d3bt2u3 g.7.1.3 (U:87-187) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
ysrsryleciscgssdmscergrhqslqcrspeeqcldvvthwikddrhlrgcgylpgcp
gsngfhnndtfhflkccnttkcnegpilelenl

SCOPe Domain Coordinates for d3bt2u3:

Click to download the PDB-style file with coordinates for d3bt2u3.
(The format of our PDB-style files is described here.)

Timeline for d3bt2u3: