![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (3 families) ![]() |
![]() | Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
![]() | Protein Urokinase plasminogen activator surface receptor, UPAR [161130] (1 species) duplication; comprises three domains of this fold |
![]() | Species Human (Homo sapiens) [TaxId:9606] [161131] (4 PDB entries) Uniprot Q03405 111-210! Uniprot Q03405 114-210! Uniprot Q03405 211-297! Uniprot Q03405 211-301! Uniprot Q03405 23-102! Uniprot Q03405 23-104 |
![]() | Domain d3bt2u2: 3bt2 U:189-275 [155548] Other proteins in same PDB: d3bt2a1, d3bt2a2, d3bt2b1, d3bt2h1, d3bt2h2, d3bt2l1, d3bt2l2 automatically matched to 2FD6 U:189-275 complexed with nag |
PDB Entry: 3bt2 (more details), 2.5 Å
SCOP Domain Sequences for d3bt2u2:
Sequence, based on SEQRES records: (download)
>d3bt2u2 g.7.1.3 (U:189-275) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]} qngrqcysckgnsthgcsseetflidcrgpmnqclvatgthepknqsymvrgcatasmcq hahlgdafsmnhidvscctksgcnhpd
>d3bt2u2 g.7.1.3 (U:189-275) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]} qngrqcysckgnsthgcsseetflidcrgpmnqclvatgthepknqsymvrgcatasmcq lgdafsmnhidvscctksgcnhpd
Timeline for d3bt2u2: