SCOPe 2.04: Domain d3bt2l1: 3bt2 L:1-106A

Lineage for d3bt2l1 (3bt2 L:1-106A)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d3bt2l1: 3bt2 L:1-106A [155545]
   Other proteins in same PDB: d3bt2a1, d3bt2a2, d3bt2b_, d3bt2h1, d3bt2h2, d3bt2l2, d3bt2u1, d3bt2u2, d3bt2u3
   automated match to d1h3pl1
   complexed with nag

Details for d3bt2l1

PDB Entry: 3bt2, 2.5 Å

PDB Description: structure of urokinase receptor, urokinase and vitronectin complex

PDB Compounds: (L:) anti-uPAR antibody, light chain

SCOPe Domain Sequences for d3bt2l1:

Sequence; same for both SEQRES and ATOM records:

>d3bt2l1 b.1.1.0 (L:1-106A) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspditaaslgqkvtitcsasssvsymhwyqqksgtspkpwifeisklasgvpar
fsgsgsgtsysltissmeaedaaiyycqqwnypftfgggtkleik

Timeline for d3bt2l1:

• d3bt2l1 first appeared in SCOP 1.75
  
• d3bt2l1 appears in SCOPe 2.03
  
• d3bt2l1 appears in SCOPe 2.05
  
• d3bt2l1 appears in the current release, SCOPe 2.07