SCOPe 2.02: Domain d3bt2l1: 3bt2 L:1-106A

Lineage for d3bt2l1 (3bt2 L:1-106A)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (15 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.4 [TaxId:10090] [88530] (6 PDB entries)

8. Domain d3bt2l1: 3bt2 L:1-106A [155545]
   Other proteins in same PDB: d3bt2a1, d3bt2a2, d3bt2b_, d3bt2h1, d3bt2h2, d3bt2l2, d3bt2u1, d3bt2u2, d3bt2u3
   automatically matched to 2FD6 L:1-106A
   complexed with nag

Details for d3bt2l1

PDB Entry: 3bt2, 2.5 Å

PDB Description: structure of urokinase receptor, urokinase and vitronectin complex

PDB Compounds: (L:) anti-uPAR antibody, light chain

SCOPe Domain Sequences for d3bt2l1:

Sequence; same for both SEQRES and ATOM records:

>d3bt2l1 b.1.1.1 (L:1-106A) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.4 [TaxId: 10090]}
divltqspditaaslgqkvtitcsasssvsymhwyqqksgtspkpwifeisklasgvpar
fsgsgsgtsysltissmeaedaaiyycqqwnypftfgggtkleik

Timeline for d3bt2l1:

• d3bt2l1 first appeared in SCOP 1.75
  
• d3bt2l1 appears in SCOPe 2.01
  
• d3bt2l1 appears in SCOPe 2.03
  
• d3bt2l1 appears in the current release, SCOPe 2.08