Lineage for d3bt2l1 (3bt2 L:1-106A)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 930396Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 930978Species Mouse (Mus musculus), cluster 3.4 [TaxId:10090] [88530] (6 PDB entries)
  8. 930983Domain d3bt2l1: 3bt2 L:1-106A [155545]
    Other proteins in same PDB: d3bt2a1, d3bt2a2, d3bt2b_, d3bt2h1, d3bt2h2, d3bt2l2, d3bt2u1, d3bt2u2, d3bt2u3
    automatically matched to 2FD6 L:1-106A
    complexed with nag

Details for d3bt2l1

PDB Entry: 3bt2 (more details), 2.5 Å

PDB Description: structure of urokinase receptor, urokinase and vitronectin complex
PDB Compounds: (L:) anti-uPAR antibody, light chain

SCOPe Domain Sequences for d3bt2l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bt2l1 b.1.1.1 (L:1-106A) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.4 [TaxId: 10090]}
divltqspditaaslgqkvtitcsasssvsymhwyqqksgtspkpwifeisklasgvpar
fsgsgsgtsysltissmeaedaaiyycqqwnypftfgggtkleik

SCOPe Domain Coordinates for d3bt2l1:

Click to download the PDB-style file with coordinates for d3bt2l1.
(The format of our PDB-style files is described here.)

Timeline for d3bt2l1: